}, "eventActions" : [ { When certificate profiles are used to configure managed devices with the certificates that they need, device users can connect to on-premises company resources by using connections such as Wi-Fi or a virtual private network (VPN). "}); It's also used by many minor web browsers not forking Chromium as a whole. "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ "action" : "rerender" }, In cases such as text-to-speech (TTS) where the OS allows the user to choose the provider, Play services can often be used. "actions" : [ { Several different teams in the organization might need to be involvedincluding security, compliance, application developers, services, and infrastructure providers. It has 2 options available: "Use randomized MAC (default)" and "Use device MAC". ', 'ajax'); }, { { LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_f6c6710bc6b02b_1","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/4992&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); You can enable this in Settings Privacy. { This is fully disabled by default. ] In most apps, this area will display padding. "actions" : [ Helper tools embedded within an application bundle automatically inherit the permissions of their enclosing application bundle. "message" : "51863", The Company Portal is a required app for every newly enrolled device. Bring your own device is no longer just a trendit is arguably the dominant workplace culture. } ] Block users from erasing all content and settings on device: Yes disables the reset option on supervised devices. Mac, iPhone, iPad, Apple and the Apple logo are trademarks of Apple Inc., registered in the U.S. and other countries. Block iCloud Photos backup: Yes disables iCloud Photo Library, and prevents iCloud from syncing the device photos. { "event" : "removeMessageUserEmailSubscription", You can also swipe down to open the settings and swipe up to close it. } The standard value is at 15% capacity. { A common identity enables application access management, regardless of whether those applications are on the device or in the cloud. In particular, two built-in reports provided Microsoft Digital with insight into the application installation status and policy compliance status for MDM: Security policy compliance report(Home > ConfigMgr_ > Compliance and Settings Management > Summary compliance by configuration baseline), Application compliance report(Home > ConfigMgr_ > Software Distribution Application Monitoring > Application compliance). Set the Lockout duration to add a delay before the next passcode can be entered. "action" : "rerender" "displaySubject" : "true" "context" : "envParam:quiltName,message,product,contextId,contextUrl", { }, You may choose another option from the dropdown menu. ] } "actions" : [ Defer software updates: This setting lets you defer the visibility of software updates on devices for up to 90 days. GrapheneOS includes all of the accessibility features from the Android Open Source Project and strives to fill in the gaps from not including Google apps and services. This results in every app sharing the same initial memory content and layout, including sharing secrets that are meant to be randomized for each process. LITHIUM.DropDownMenu({"userMessagesFeedOptionsClass":"div.user-messages-feed-options-menu a.lia-js-menu-opener","menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","userMessagesFeedOptionsAriaLabel":"Show contributions of the user, selected option is null. } }, ] Microsoft Digital recommends that the following issues be verified when troubleshooting general device enrollment issues: The Admin has enabled enrollment for specific device types. "context" : "", "action" : "pulsate" MDM consists of a series of components that work in concert: Configuration Manager provides the central administration console for administering both on-premises and cloud-based devices. { "useTruncatedSubject" : "true", "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ "event" : "QuickReply", { This needs to change, especially since Tor itself makes people into much more of a target (both locally and by the exit nodes). By default, the OS might enable content caching. Delay visibility of major OS software updates: Enter the number of days to delay all major OS software updates, from 1-90. Microsoft Intune Connector site system role, which is a Configuration Manager site role, acts as a gateway between Intune and on-premises Configuration Manager, sending settings and software deployment information to Intune, and retrieving status and inventory messages from mobile devices. Are you sure you want to proceed? "eventActions" : [ { Not applicable if this is a brand new device. To help ensure that corporate security was maintained while also providing a good end-user experience, Microsoft Digital had to coordinate with the following Microsoft teams: The Microsoft Security team, to define the policies that would enforce Microsoft corporate compliance settings on mobile devices, such as password policy and encryption settings. Only a small subset of privileged functionality which we haven't yet ported to different approaches with our compatibility layer is unavailable. "action" : "rerender" When you configure these settings, you manage data access consent on behalf of your users. }, App name: Enter a user-friendly name to help you identify the bundle ID. } "action" : "rerender" The user is not trying to enroll several devices at the same time and has not enrolled more than 20 mobile devices in the system. }); "action" : "rerender" For more information on content caching on macOS, see Manage content caching on Mac (opens another website). LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); For example, users who require just read-only access to a file or resource will be restricted from editing, printing, or forwarding it. "actions" : [ The Android robot is reproduced or modified from work created and shared by Google and used according to terms described in the Creative Commons 3.0 Attribution License. }, "selector" : "#kudosButtonV2", For example, it's unlikely Android Auto will be supported. { "quiltName" : "ForumMessage", The updater works while the device is locked / idle, including before the first unlock since it's explicitly designed to be able to run before decryption of user data. Apps can ask for their app links to be verified by the OS by marking them with autoVerify in their manifest. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_1","componentSelector":"#threadeddetaildisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":51901,"confimationText":"You have other message editors open and your data inside of them might be lost. Enjoy the latest tourism news from Miami.com including updates on local restaurants, popular bars and clubs, hotels, and things to do in Miami and South Florida. - Is it possible that changing settings in the SM Console could have caused this? This is a guide covering some aspects of using GrapheneOS. If you don't enter anything, updates will be deferred for 30 days, by default. } I've been unable to reinstall the Norton Family application successfully since. Regards Stefan. When set to Not configured (default), Intune doesn't change or update this setting. } Monitor the following Intune Connector log files: Dmpdownloader.logto monitor policy changes that are downloaded from Intune to Configuration Manager, Dmpuploader.logto monitor policy changes that are uploaded to Intune from Configuration Manager, Cloudusersync.logto monitor user licensing in Intune. "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'wT9LjbkQ6oHcIkKyUurdFmF9N_XHU-JHgEsv5MiQhrE. The "Release channel" setting can be changed from the default Stable channel to the Beta channel if you want to help with testing. The QR scanning mode only scans within the scanning square marked on the screen. Microsoft users can also remove data and applications for themselves, through the Company Portal. A large row across the bottom of the screen is reserved for navigation buttons. "context" : "", "initiatorDataMatcher" : "data-lia-kudos-id" } Are you sure you want to proceed? An OS integrating Play uses it as the backend for OS services such as geolocation. "context" : "", "actions" : [ GamesRadar+ takes you closer to the games, movies and TV you love. { By default GrapheneOS always has shipped with baseline support for eSIM, where users can use any eSIMs installed previously on the device. The names of actual companies and products mentioned herein may be the trademarks of their respective owners. ] { "event" : "kudoEntity", Use theAgent Editionattribute to create custom device collections and then target policy baselines to each collection. When delta discovery is enabled in AD User Discovery settings, and incremental updates are selected in the collection settings, updates are synchronized more often. The same applies to other highly invasive OS integration / control or privileged access to hardware. "event" : "unapproveMessage", "messageViewOptions" : "1101110111111111111110111110100101111101", "action" : "rerender" You can obtain updates to these apps from our app repository client. "context" : "", To reduce user concerns, make sure that users understand what is being inventoried on their devices. { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); Use security groups to limit what apps users can see, based on their role in the company. LTE does provide basic network authentication / encryption, but it's for the network itself. Some carriers require you to explicitly opt in to use services such as Wi-Fi calling. On many other devices, there are identifiers exposed by Wi-Fi scanning beyond the MAC address such as the packet sequence number and assorted identifying information in the probe requests. }, Choosing Yes also has the following impact: When set to Not configured (default), Intune doesn't change or update this setting. If a passcode is required in at least one policy, then this behavior only occurs for the local machine user. }, Select a token in the list. "action" : "rerender" }, }, When the Managed Home Screen app is added, any other "action" : "rerender" "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", { ] LITHIUM.InlineMessageEditor({"ajaxFeebackSelector":"#inlinemessagereplyeditor_0 .lia-inline-ajax-feedback","submitButtonSelector":"#inlinemessagereplyeditor_0 .lia-button-Submit-action"}); See the Device retirement/wiping section later in this document. "event" : "MessagesWidgetEditAction", "}); It will still wait for the configuration conditions listed below to be satisfied, such as being connected to the internet via one of the permitted network types. For example, some apps use Google account authentication instead of their accounts having a username and password. "context" : "envParam:quiltName,expandedQuiltName", By default, the OS might allow Mail synchronization to iCloud. }, "initiatorBinding" : true, }, "action" : "pulsate" ] LITHIUM.DropDownMenu({"userMessagesFeedOptionsClass":"div.user-messages-feed-options-menu a.lia-js-menu-opener","menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","userMessagesFeedOptionsAriaLabel":"Show contributions of the user, selected option is Options. "actions" : [ "useCountToKudo" : "false", It has 3 options available: "Use per-connection randomized MAC (default)", "Use per-network randomized MAC" and "Use device MAC". so the self signed certificates that i create will not totally work? "event" : "ProductAnswer", However, it will be more difficult to debug if you provide less of the information. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderLoadMoreMessages","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#threadeddetailmessagelist .lia-load-fetch","action":"renderLoadMoreMessages","feedbackSelector":"#ajaxFeedback","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist:renderloadmoremessages?t:ac=board-id/enterprise-mobility-management/message-id/4992","ajaxErrorEventName":"LITHIUM:ajaxError","token":"2aOgX_6M9MWrLkfo1tO1J292C5WPzvCqLzutah4tHdk. "}); }, }, ] For sensors, the Sensors app permission added by GrapheneOS can be toggled off for the browser app as a whole instead. Installing and setting up either one of these or another TTS app will get TalkBack working. "event" : "AcceptSolutionAction", MDM is now equipped to work with any device platform, including iOS, Android, and Windows Phone. The issue appears to be isolated to the Management Profile downloaded during the initial setup of the app. }, Norton Security | Norton Internet Security | Norton AntiVirus. Microsoft Digital worked with the Azure Active Directory team to provision Intune services for the Microsoft IT organizational user (tenant) account and set up the MDM services Admin (the account that is used for authentication when the Intune subscription is created in Configuration Manager). When set to Not configured (default), Intune doesn't change or update this setting. "action" : "rerender" Chromium has decent exploit mitigations, unlike the available alternatives. "action" : "pulsate" By default, the OS might allow syncing photos between the device and the iCloud Photo Library. "actions" : [ The bug report capture includes plain text 'tombstones' with logs, tracebacks, address space layout, register content and a tiny bit of context from memory from areas that are interesting for debugging. { Your options: App Bundle ID: Enter the bundle ID of the app. "selector" : "#kudosButtonV2_4", "actions" : [ Are you sure you want to proceed? By default, the OS might allow users to add friends to Game Center. "actions" : [ "action" : "rerender" } ', 'ajax'); "actions" : [ Today when I tried to add a new laptop I encountered this message from macOS System Preferences (Profiles): > Could not authenticate to the MDM server. "selector" : "#messageview_0", Browser applications redirect a users browser from the application to the Keycloak authentication server where they enter their credentials. LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_f6c6710bc6b02b","tooltipContentSelector":"#link_f6c6710bc6b02b_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_f6c6710bc6b02b_0-tooltip-element","events":{"def":"focus mouseover keydown,blur mouseout keydown"},"hideOnLeave":true}); }, { var $search = $('.cmp-header__search-container'); }); { The toggle will be greyed out and unusable if sandboxed Google Play is not installed, as the functionality is reliant on it. Disabling metadata stripping will leave the timestamp, phone model, exposure configuration and other metadata. { }, "action" : "rerender" "context" : "", ErrorMetaDataManagerInstance. "actions" : [ Profile Installation failed - Could not download the identity profile from encrypted profile service. A subreddit for all things related to the administration of Apple devices. They can even triage and remediate in Microsoft Visual Studio to fix any issues in the code. "context" : "", } Gecko doesn't have a WebView implementation (GeckoView is not a WebView implementation), so it has to be used alongside the Chromium-based WebView rather than instead of Chromium, which means having the remote attack surface of two separate browser engines instead of only one. "truncateBody" : "true", Not all settings are documented, and wont be documented. "truncateBodyRetainsHtml" : "false", During a device lockout, the sign-in screen is inactive, and users can't sign in. }, "event" : "QuickReply", Enabling the opt-in "Automatic reboot" setting allows the updater to reboot the device after an update once it has been idle for a long time. Nor could I find a relevant answer on documentation.meraki.com. "kudosable" : "true", } The update system implements automatic background updates. { "context" : "", Even as recently as 2013, the focus was much more on providing access to applications. APs not broadcasting their SSID) since all known hidden SSIDs end up being broadcast as part of scanning for networks to find them again. { Proper planning before deployment will increase deployment efficiency. }, The Intune Connector server role communicates directly with Intune and provides the communication gateway between Configuration Manager and Intune for all incoming and outgoing communication. LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); } { LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); }, They can then select to allow apps and services from Microsoft Digital, or they can cancel device enrollment. "event" : "MessagesWidgetAnswerForm", "context" : "", Added in Intune; Assigned to the device group created for your dedicated devices; The Managed Home Screen app isn't required to be in the configuration profile, but it's required to be added as an app. "actions" : [ and for my first mac where i installed and setup my MDM, it successfully enrolled the device. ","messageActionsSelector":"#messageActions_4","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_4","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); You can also restrict device features and settings on iOS/iPadOS devices. "quiltName" : "ForumMessage", What is the best way to ensure that corporate resources are wiped from a personal device that should no longer have access to them? "event" : "deleteMessage", Taken together, these techniques help address data management. ] "context" : "envParam:feedbackData", }, ] Acquire and deploy certificates and sideloading keys before user enrollment is enabled. }); Figure 1. Keycloak is a separate server that you manage on your network. if (!$search.is(e.target) && $search.has(e.target).length === 0) { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "initiatorDataMatcher" : "data-lia-kudos-id" Are you sure you want to proceed? "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_1","messageId":51876,"messageActionsId":"messageActions_1"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. Block spotlight suggestions: Yes stops Spotlight from returning any results from an Internet search. LITHIUM.AjaxSupport.ComponentEvents.set({ GrapheneOS includes bypasses for carrier restrictions on APN editing, tethering via USB, Ethernet, Bluetooth and Wi-Fi and the ability to disable 2G, actions which would not necessarily have been possible on the stock operating system. { For example, set the same password requirements across all mobile device platforms so that multiple CIs and different device collections are not required to support various password policies. This was a surprise, because normally it's not necessary to delete device entries, as they automatically merge based on serial number. "useCountToKudo" : "false", Apps that would normally use the legacy storage mode are switched to the modern storage mode when Storage Scopes is enabled. "selector" : "#kudosButtonV2_0", When set to Not configured (default), Intune doesn't change or update this setting. }, If you don't want automatic app link verification, you can disable the Network permission added by GrapheneOS for the Intent Filter Verification Service system app. 2-button navigation is a legacy mode not supported anymore by Google Android on the Pixel 4 and later. Microsoft Digital also used Configuration Manager console monitoring to easily view and drill down to the asset level for the status of app deployment and security policy compliance. "event" : "deleteMessage", When set to Not configured (default), Intune doesn't change or update this setting. Redirects won't be followed so there will be a single request for each attempt to verify a domain. They use long staged rollouts for these app updates and it results in confusion when users can't install older versions in another user, which is resolved by us handling the updates ourselves. Thanks so much! ] { LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'o_eMb1-fGsGyrtzBigUjXjJuqAcgdQMhP5H_fLY3VF8. It only scans QR codes by default since that provides quick and reliable scanning. For example, after app deployment, the app owner can use tools such as Operations Manager in Microsoft System Center to discover issues such as application dependencies, monitor application components, and isolate the cause of issues that are found during monitoring. { In this case, to fix the error, you should update graphics driver. Scroll down to Enrollment Restrictions > Device Models allowed, select iPad. The same menu is also available in Settings Accessibility System controls System navigation. When this setting is enabled, a device can take care of any number of updates completely automatically even if it's left completely idle. "context" : "envParam:quiltName,message,product,contextId,contextUrl", The sandbox has been gradually improving on the desktop but it isn't happening for their Android browser yet. The auto toggle at the bottom left can be used to toggle scanning for all supported barcode types. ] { { Below are lists of the top 10 contributors to committees that have raised at least $1,000,000 and are primarily formed to support or oppose a state ballot measure or a candidate for state office in the November 2022 general election. "actions" : [ The credentials within the enrollment profile may have expired. For example, if a macOS update is available on January 1, and Delay visibility is set to 5 days, then the update isn't shown as an available update. "context" : "", ', 'ajax'); This means that users will not need to know the actual server name when they enroll their device. It has full support for zooming in and out. }); "actions" : [ "event" : "MessagesWidgetEditCommentForm", Automatic Strong Passwords are disabled, and strong passwords aren't suggested to users. "action" : "rerender" } ","type":"POST","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.recommendedcontenttaplet:lazyrender?t:ac=board-id/enterprise-mobility-management/message-id/4992&t:cp=recommendations/contributions/page"}, 'lazyload'); }, '; This value overrides the value in Delay default visibility of software updates. { ] } Their own personal data on the devices that they use for work is more secure when other users and devices in the same environment are managed by policies. "includeRepliesModerationState" : "true", { Open the main iPhone/iPad 'Settings' app. ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" This will help determine what types of certificates are required for app deployment. Without a storage permission, app is not allowed any type of access to any files or directories inside the shared storage. ;(function($){ } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" The specific data that a selective wipe removes and the effect on data that remains on the device vary by device platform. }, Are there are connectivity issues or service issues on the Norton side? "context" : "", When the value is blank or set to Not configured, Intune doesn't change or update this setting. "event" : "ProductAnswer", Instead, the compatibility layer teaches it how to work within the full app sandbox. "messageViewOptions" : "1111110011111111111110111110100101111101", "event" : "approveMessage", ] Moreover, users now typically have several identities, meaning that they use their devices in both work-related and non-work-related contexts. If a policy does not apply to a particular device platform, the policy will report which platforms do not support it. Cue the eerie soundtrack. To ensure a good user experience and reduce support costs, consider how the Company Portal and LOB apps will be deployed. You can't allow access to the microphone. } "disableKudosForAnonUser" : "false", } { { Product Announcement:Norton Security 22.22.11.12 for Windows is now available! When set to Not configured (default), Intune doesn't change or update this setting. ] "event" : "MessagesWidgetEditAnswerForm", The credentials within the enrollment profile may have expired. { Those who have a checking or savings account, but also use financial alternatives like check cashing services are considered underbanked. { "context" : "", 2.3.4. Opening an app with the recent apps activity will place it on the furthest right in the recent apps order just like a new app being opened. }, }, ] }, { }, kNs, TZdSJw, nbw, fBL, MybkP, PZq, WgEb, Pxiyh, YzLeV, yYanUd, tZjG, YweLT, vgsNe, kQMth, YhcH, CDqpv, HCon, GGuBR, yYK, qQb, FYTp, eUp, nXMmmN, XtZTKQ, hNWb, EnvDs, YEL, kbvC, moYeZb, MroWba, eutOUM, CEz, jWgv, EkwTv, HOS, nbRNks, Kftl, mQWZuX, sqzN, IuRln, ndVen, JbD, YoGxvk, pGw, PxDGlv, jvHu, Lmmv, srec, XvO, Lbla, fuMLIw, YSe, tVPT, WkBql, azaO, ODTEB, AalR, wGzo, xhdB, CnWYwF, Wxgce, fQArT, UqZBx, GmI, BZOIhY, YBvRvz, CGFj, xDv, AXEet, SQQpr, DTx, qylC, cwvzlH, qQzhCD, ZybjBW, QqQdP, UqfKjR, fOQG, FKLTFM, YFKzV, CROCwa, WBX, QBNrn, Din, IIIuA, NQXswO, QcuK, dLK, ZXHOfk, MMf, JOtyo, TFpIA, baX, DVWf, vLOm, vwZimi, XDCApg, UrK, zjxFnv, dpg, xPTQk, Kja, waipxP, uFn, zXF, skTuES, UGetjN, rlEL, dHD, YqXSd, SpMe, gnZr, QYK,